Annexin A2 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A11235
Artikelname: Annexin A2 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A11235
Hersteller Artikelnummer: A11235
Alternativnummer: ABB-A11235-100UL,ABB-A11235-20UL,ABB-A11235-500UL,ABB-A11235-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270, Annexin A2
This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0554]
Molekulargewicht: 39kDa
NCBI: 302
UniProt: P07355
Reinheit: Affinity purification
Sequenz: MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL
Target-Kategorie: ANXA2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:800 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Annexin A2 Rabbit mAb (A11235) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Annexin A2 Rabbit mAb (A11235) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using Annexin A2 Rabbit mAb (A11235) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Annexin A2 Rabbit mAb (A11235) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Annexin A2 Rabbit mAb (A11235) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Annexin A2 Rabbit mAb (A11235) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Annexin A2 Rabbit mAb (A11235) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.