beta-arrestin1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A0998
- Bilder (8)
| Artikelname: | beta-arrestin1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A0998 |
| Hersteller Artikelnummer: | A0998 |
| Alternativnummer: | ABB-A0998-100UL,ABB-A0998-20UL,ABB-A0998-500UL,ABB-A0998-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ARB1, ARR1, beta-arrestin1 |
| Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 47kDa |
| NCBI: | 408 |
| UniProt: | P49407 |
| Reinheit: | Affinity purification |
| Sequenz: | RKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR |
| Target-Kategorie: | ARRB1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Cell Biology Developmental Biology,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat heart using beta-arrestin1 Rabbit pAb (A0998) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Mouse spleen using beta-arrestin1 Rabbit pAb (A0998) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining. |
|
|
Western blot analysis of various lysates using beta-arrestin1 Rabbit pAb (A0998) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
|
|
Immunofluorescence analysis of A-549 cells using beta-arrestin1 Rabbit pAb (A0998) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of HepG2 cells using beta-arrestin1 Rabbit pAb (A0998) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of NIH/3T3 cells using beta-arrestin1 Rabbit pAb (A0998) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of PC-12 cells using beta-arrestin1 Rabbit pAb (A0998) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunoprecipitation analysis of 200 µg extracts of SH-SY5Y cells using 3 µg beta-arrestin1 antibody (A0998). Western blot was performed from the immunoprecipitate using beta-arrestin1 (A0998) at a dilution of 1:1000. |
Produktgarantie und fachkundiger Support
