Cytokeratin 13 (KRT13) Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A0411
Artikelname: Cytokeratin 13 (KRT13) Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A0411
Hersteller Artikelnummer: A0411
Alternativnummer: ABB-A0411-100UL,ABB-A0411-20UL,ABB-A0411-500UL,ABB-A0411-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: K13, CK13, WSN2, Cytokeratin 13 (KRT13)
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants, however, not all variants have been described.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1824]
Molekulargewicht: 50 kDa
NCBI: 3860
UniProt: P13646
Reinheit: Affinity purification
Sequenz: LTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELAL
Target-Kategorie: KRT13
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:5000 - 1:20000|IF-P,1:100 - 1:1000|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung using Cytokeratin 13 (KRT13) Rabbit mAb (A0411) at 1:10000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45 s.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Cytokeratin 13 (KRT13) Rabbit mAb (A0411) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates using Cytokeratin 13 (KRT13) Rabbit mAb (A0411) at 1:10000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): U-2 OS, 293F.
Exposure time: 20 s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 13 (KRT13) Rabbit mAb (A0411) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded rat bladder using Cytokeratin 13 (KRT13) (KRT13) Rabbit mAb (A0411) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded human cervix cancer using Cytokeratin 13 (KRT13) (KRT13) Rabbit mAb (A0411) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse bladder using Cytokeratin 13 (KRT13) (KRT13) Rabbit mAb (A0411) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.