RHCG Antibody - C-terminal region
Catalog Number:
ASB-ARP42466_P050
- Images (6)
| Article Name: | RHCG Antibody - C-terminal region |
| Biozol Catalog Number: | ASB-ARP42466_P050 |
| Supplier Catalog Number: | ARP42466_P050 |
| Alternative Catalog Number: | ASB-ARP42466_P050-25UL,ASB-ARP42466_P050-100UL |
| Manufacturer: | Aviva |
| Host: | Rabbit |
| Category: | Proteine/Peptide |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL |
| Alternative Names: | RHGK, PDRC2, C15orf6, SLC42A3 |






