SRC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2139984
Article Name: SRC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139984
Supplier Catalog Number: orb2139984
Alternative Catalog Number: BYT-ORB2139984-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SRC
Conjugation: HRP
Alternative Names: ASV, SRC1, THC6, c-SRC, p60-Src
SRC Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 005408
UniProt: P12931
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG