RHCG Antibody - C-terminal region
Artikelnummer:
ASB-ARP42466_P050
- Bilder (6)
| Artikelname: | RHCG Antibody - C-terminal region |
| Artikelnummer: | ASB-ARP42466_P050 |
| Hersteller Artikelnummer: | ARP42466_P050 |
| Alternativnummer: | ASB-ARP42466_P050-25UL,ASB-ARP42466_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence NCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPL |
| Alternative Synonym: | RHGK, PDRC2, C15orf6, SLC42A3 |
|
|
Anti-RHCG antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
|
Anti-RHCG antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
|
Host: Rabbit Target Name: RHCG Sample Tissue: Human OVCAR-3 Whole Cell Antibody Dilution: 3ug/ml |
|
|
Host: Rabbit Target Name: RHCG Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 3ug/ml |
|
|
Host: Rabbit Target Name: RHCG Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 3ug/ml |
|
|
RHCG Antibody - C-terminal region (ARP42466_P050) in Human OVCAR-3 Whole Cell using Western Blot |
Produktgarantie und fachkundiger Support
