Recombinant Human Nucleoside diphosphate kinase B (NME2), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC25740
Artikelname: Recombinant Human Nucleoside diphosphate kinase B (NME2), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC25740
Hersteller Artikelnummer: RPC25740
Alternativnummer: BIM-RPC25740-20UG,BIM-RPC25740-100UG,BIM-RPC25740-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC:2.7.13.3), nm23-H2, NM23B)
Recombinant Human Nucleoside diphosphate kinase B (NME2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: NME2. Target Synonyms: C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC:2.7.13.3), nm23-H2, NM23B). Accession Number: P22392. Expression Region: 2~152aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Target-Kategorie: NME2